SCOPe 2.05: Domain d2gwse2: 2gws E:329-385

Lineage for d2gwse2 (2gws E:329-385)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase lambda [101253] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101254] (26 PDB entries)

8. Domain d2gwse2: 2gws E:329-385 [135817]
   Other proteins in same PDB: d2gwsa1, d2gwsa3, d2gwse1, d2gwse3, d2gwsi1, d2gwsi3, d2gwsm1, d2gwsm3
   automated match to d2pfna2
   protein/DNA complex; complexed with cac, cl, edo, mg, na

Details for d2gwse2

PDB Entry: 2gws, 2.4 Å

PDB Description: crystal structure of human dna polymerase lambda with a g/g mismatch in the primer terminus

PDB Compounds: (E:) DNA polymerase lambda

SCOPe Domain Sequences for d2gwse2:

Sequence; same for both SEQRES and ATOM records:

>d2gwse2 a.60.12.1 (E:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

Timeline for d2gwse2:

• d2gwse2 first appeared in SCOP 1.73
  
• d2gwse2 appears in SCOPe 2.04
  
• d2gwse2 appears in SCOPe 2.06
  
• d2gwse2 appears in the current release, SCOPe 2.08