Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase lambda [101251] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101252] (17 PDB entries) |
Domain d2gwse1: 2gws E:250-327 [135816] Other proteins in same PDB: d2gwsa2, d2gwsa3, d2gwse2, d2gwse3, d2gwsi2, d2gwsi3, d2gwsm2, d2gwsm3 automatically matched to d1nzpa_ complexed with cac, cl, edo, mg, na |
PDB Entry: 2gws (more details), 2.4 Å
SCOP Domain Sequences for d2gwse1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gwse1 a.60.6.1 (E:250-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm aekiieilesghlrkldh
Timeline for d2gwse1: