| Class b: All beta proteins [48724] (165 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Fungal alpha-amylase [51028] (2 species) |
| Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (5 PDB entries) |
| Domain d2gvyb1: 2gvy B:382-476 [135795] Other proteins in same PDB: d2gvya2, d2gvyb2 automatically matched to d6taa_1 complexed with ca, glc, nag |
PDB Entry: 2gvy (more details), 1.8 Å
SCOP Domain Sequences for d2gvyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvyb1 b.71.1.1 (B:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics
Timeline for d2gvyb1: