Lineage for d2gvhc1 (2gvh C:9-143)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858618Family d.38.1.1: 4HBT-like [54638] (18 proteins)
    Pfam PF03061
  6. 858710Protein Probable acyl-CoA hydrolase AGR_L_2016 [143148] (1 species)
  7. 858711Species Agrobacterium tumefaciens [TaxId:358] [143149] (1 PDB entry)
    Uniprot Q7CTE6 147-262! Uniprot Q7CTE6 9-143
  8. 858716Domain d2gvhc1: 2gvh C:9-143 [135780]
    automatically matched to 2GVH A:9-143
    complexed with na

Details for d2gvhc1

PDB Entry: 2gvh (more details), 2.5 Å

PDB Description: crystal structure of acyl-coa hydrolase (15159470) from agrobacterium tumefaciens at 2.65 a resolution
PDB Compounds: (C:) AGR_L_2016p

SCOP Domain Sequences for d2gvhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvhc1 d.38.1.1 (C:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]}
kpaqhgattrlidivfpgdtnhhgtlfggtglalmdrvafiaatrfgrtpfvtascerid
frqparighiveftarpvkagrrsltvevemvaetiigrqqhtctrgifhmvaipegeda
asyvlpellteetpd

SCOP Domain Coordinates for d2gvhc1:

Click to download the PDB-style file with coordinates for d2gvhc1.
(The format of our PDB-style files is described here.)

Timeline for d2gvhc1: