Lineage for d2guya1 (2guy A:382-476)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328126Protein Fungal alpha-amylase [51028] (2 species)
  7. 1328129Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries)
  8. 1328130Domain d2guya1: 2guy A:382-476 [135754]
    Other proteins in same PDB: d2guya2
    automated match to d7taaa1
    complexed with ca

Details for d2guya1

PDB Entry: 2guy (more details), 1.59 Å

PDB Description: orthorhombic crystal structure (space group p21212) of aspergillus niger alpha-amylase at 1.6 a resolution
PDB Compounds: (A:) alpha-amylase A

SCOPe Domain Sequences for d2guya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2guya1 b.71.1.1 (A:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics

SCOPe Domain Coordinates for d2guya1:

Click to download the PDB-style file with coordinates for d2guya1.
(The format of our PDB-style files is described here.)

Timeline for d2guya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2guya2