Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Fungal alpha-amylase [51028] (2 species) |
Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries) |
Domain d2guya1: 2guy A:382-476 [135754] Other proteins in same PDB: d2guya2 automated match to d7taaa1 complexed with ca |
PDB Entry: 2guy (more details), 1.59 Å
SCOPe Domain Sequences for d2guya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2guya1 b.71.1.1 (A:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct tvtvgsdgnvpvpmagglprvlypteklagskics
Timeline for d2guya1: