SCOP 1.75: Domain d2guod1: 2guo D:182-275

Lineage for d2guod1 (2guo D:182-275)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
   Uniprot P30685 25-300
   Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor
   Uniprot P30481 25-300
   Uniprot P01892 25-298
   Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d2guod1: 2guo D:182-275 [135741]
   Other proteins in same PDB: d2guoa2, d2guob1, d2guod2, d2guoe1
   automatically matched to d1akja1
   complexed with gol, na

Details for d2guod1

PDB Entry: 2guo, 1.9 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the native nonameric Melan-A/MART-1(27-35) peptide

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d2guod1:

Sequence; same for both SEQRES and ATOM records:

>d2guod1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d2guod1:

• d2guod1 first appeared in SCOP 1.73
  
• d2guod1 appears in SCOPe 2.01
  
• d2guod1 appears in the current release, SCOPe 2.08