Lineage for d2gtzd2 (2gtz D:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856344Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
    Uniprot P01892 25-298
  8. 856358Domain d2gtzd2: 2gtz D:1-181 [135719]
    Other proteins in same PDB: d2gtza1, d2gtzb1, d2gtzd1, d2gtze1
    automatically matched to d1akja2
    complexed with gol, na; mutant

Details for d2gtzd2

PDB Entry: 2gtz (more details), 1.7 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the nonameric Melan-A/MART-1(27-35) peptide having A28L substitution
PDB Compounds: (D:) HLA-A*0201 heavy chain

SCOP Domain Sequences for d2gtzd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtzd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d2gtzd2:

Click to download the PDB-style file with coordinates for d2gtzd2.
(The format of our PDB-style files is described here.)

Timeline for d2gtzd2: