SCOPe 2.04: Domain d2gtpb2: 2gtp B:32-60,B:182-348

Lineage for d2gtpb2 (2gtp B:32-60,B:182-348)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Human (Homo sapiens) [TaxId:9606] [159560] (7 PDB entries)

8. Domain d2gtpb2: 2gtp B:32-60,B:182-348 [135681]
   Other proteins in same PDB: d2gtpa1, d2gtpb1, d2gtpc_, d2gtpd_
   automatically matched to d1kjya2
   complexed with alf, gdp, mg

Details for d2gtpb2

PDB Entry: 2gtp, 2.55 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS1 and activated Gi alpha 1

PDB Compounds: (B:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2gtpb2:

Sequence; same for both SEQRES and ATOM records:

>d2gtpb2 c.37.1.8 (B:32-60,B:182-348) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviiknnl

Timeline for d2gtpb2:

• d2gtpb2 first appeared in SCOP 1.73
  
• d2gtpb2 appears in SCOPe 2.03
  
• d2gtpb2 appears in SCOPe 2.05
  
• d2gtpb2 appears in the current release, SCOPe 2.08