Class a: All alpha proteins [46456] (285 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [158559] (7 PDB entries) |
Domain d2gtpa1: 2gtp A:61-181 [135678] Other proteins in same PDB: d2gtpa2, d2gtpb2, d2gtpc_, d2gtpd_ automatically matched to d1kjya1 complexed with alf, gdp, mg |
PDB Entry: 2gtp (more details), 2.55 Å
SCOPe Domain Sequences for d2gtpa1:
Sequence, based on SEQRES records: (download)
>d2gtpa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk t
>d2gtpa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlamtaelagvi krlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt
Timeline for d2gtpa1:
View in 3D Domains from other chains: (mouse over for more information) d2gtpb1, d2gtpb2, d2gtpc_, d2gtpd_ |