SCOP 1.73: Domain d2gtpa1: 2gtp A:61-181

Lineage for d2gtpa1 (2gtp A:61-181)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (24 PDB entries)

8. Domain d2gtpa1: 2gtp A:61-181 [135678]
   Other proteins in same PDB: d2gtpa2, d2gtpb2
   automatically matched to d1kjya1
   complexed with alf, gdp, mg

Details for d2gtpa1

PDB Entry: 2gtp, 2.55 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS1 and activated Gi alpha 1

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOP Domain Sequences for d2gtpa1:

Sequence, based on SEQRES records:

>d2gtpa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Sequence, based on observed residues (ATOM records):

>d2gtpa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlamtaelagvi
krlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt

Timeline for d2gtpa1:

• d2gtpa1 is new in SCOP 1.73
  
• d2gtpa1 appears in SCOP 1.75
  
• d2gtpa1 appears in the current release, SCOPe 2.08