Lineage for d2gtlm1 (2gtl M:102-225)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073940Superfamily b.61.7: Extracellular hemoglobin linker subunit, receptor domain [141480] (1 family) (S)
  5. 2073941Family b.61.7.1: Extracellular hemoglobin linker subunit, receptor domain [141481] (3 proteins)
  6. 2073948Protein Hemoglobin linker chain l1 [141482] (1 species)
  7. 2073949Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [141483] (1 PDB entry)
    Uniprot Q9GV76 127-240
  8. 2073950Domain d2gtlm1: 2gtl M:102-225 [135667]
    Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3
    complexed with ca, cmo, hem, zn

Details for d2gtlm1

PDB Entry: 2gtl (more details), 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution
PDB Compounds: (M:) Hemoglobin linker chain L1

SCOPe Domain Sequences for d2gtlm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtlm1 b.61.7.1 (M:102-225) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
lnithvgssytglatwtscedlnpdhaivtitaahrksffpnrvwlratlsyeldehdht
vsttqlrgfynfgkrelllaplkgqsegygvicdfnlgdddhadckivvpsslfvcahfn
aqry

SCOPe Domain Coordinates for d2gtlm1:

Click to download the PDB-style file with coordinates for d2gtlm1.
(The format of our PDB-style files is described here.)

Timeline for d2gtlm1: