SCOP 1.73: Domain d2gtdb2: 2gtd B:122-248

Lineage for d2gtdb2 (2gtd B:122-248)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.13: CoaX-like [142484] (1 protein)
   Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf

6. Protein Type III pantothenate kinase, CoaX [142485] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [142486] (1 PDB entry)

8. Domain d2gtdb2: 2gtd B:122-248 [135637]
   automatically matched to 2GTD A:122-248

Details for d2gtdb2

PDB Entry: 2gtd, 2 Å

PDB Description: crystal structure of a type iii pantothenate kinase: insight into the catalysis of an essential coenzyme a biosynthetic enzyme universally distributed in bacteria

PDB Compounds: (B:) Type III pantothenate kinase

SCOP Domain Sequences for d2gtdb2:

Sequence; same for both SEQRES and ATOM records:

>d2gtdb2 c.55.1.13 (B:122-248) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}
kngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgkd
teenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltikg
vyhfcfg

Timeline for d2gtdb2:

• d2gtdb2 is new in SCOP 1.73
  
• d2gtdb2 appears in SCOP 1.75
  
• d2gtdb2 appears in the current release, SCOPe 2.08