Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) duplication contains two domains of this fold |
Family c.55.1.13: CoaX-like [142484] (1 protein) Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf |
Protein Type III pantothenate kinase, CoaX [142485] (3 species) |
Species Thermotoga maritima [TaxId:2336] [142486] (1 PDB entry) |
Domain d2gtdb2: 2gtd B:122-248 [135637] automatically matched to 2GTD A:122-248 |
PDB Entry: 2gtd (more details), 2 Å
SCOP Domain Sequences for d2gtdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtdb2 c.55.1.13 (B:122-248) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]} kngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgkd teenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltikg vyhfcfg
Timeline for d2gtdb2: