SCOPe 2.07: Domain d2gsmd2: 2gsm D:30-129

Lineage for d2gsmd2 (2gsm D:30-129)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81457] (7 PDB entries)

8. Domain d2gsmd2: 2gsm D:30-129 [135594]
   Other proteins in same PDB: d2gsma_, d2gsmb1, d2gsmb3, d2gsmc_, d2gsmd1, d2gsmd3
   automated match to d3fyeb1
   complexed with ca, cd, cu, dmu, hea, mg, oh, trd

Details for d2gsmd2

PDB Entry: 2gsm, 2 Å

PDB Description: catalytic core (subunits i and ii) of cytochrome c oxidase from rhodobacter sphaeroides

PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2gsmd2:

Sequence; same for both SEQRES and ATOM records:

>d2gsmd2 f.17.2.1 (D:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

Timeline for d2gsmd2:

• d2gsmd2 first appeared in SCOP 1.73
  
• d2gsmd2 appears in SCOPe 2.06
  
• d2gsmd2 appears in the current release, SCOPe 2.08