![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
![]() | Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
![]() | Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81457] (6 PDB entries) |
![]() | Domain d2gsmd2: 2gsm D:30-129 [135594] Other proteins in same PDB: d2gsma_, d2gsmb1, d2gsmc_, d2gsmd1 automated match to d3fyeb1 complexed with ca, cd, cu, dmu, hea, mg, oh, trd |
PDB Entry: 2gsm (more details), 2 Å
SCOPe Domain Sequences for d2gsmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsmd2 f.17.2.1 (D:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]} leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk vparfthnspleiawtivpivilvaigafslpvlfnqqei
Timeline for d2gsmd2:
![]() Domains from other chains: (mouse over for more information) d2gsma_, d2gsmb1, d2gsmb2, d2gsmc_ |