Lineage for d2gsmd1 (2gsm D:130-281)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660834Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 660835Protein Cytochrome c oxidase [49544] (4 species)
  7. 660868Species Rhodobacter sphaeroides [TaxId:1063] [74870] (3 PDB entries)
  8. 660870Domain d2gsmd1: 2gsm D:130-281 [135593]
    Other proteins in same PDB: d2gsma1, d2gsmb2, d2gsmc1, d2gsmd2
    automatically matched to d1m56b1
    complexed with ca, cd, cu, dmu, hea, mg, oh, trd

Details for d2gsmd1

PDB Entry: 2gsm (more details), 2 Å

PDB Description: catalytic core (subunits i and ii) of cytochrome c oxidase from rhodobacter sphaeroides
PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2gsmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsmd1 b.6.1.2 (D:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq

SCOP Domain Coordinates for d2gsmd1:

Click to download the PDB-style file with coordinates for d2gsmd1.
(The format of our PDB-style files is described here.)

Timeline for d2gsmd1: