Lineage for d2gsmc_ (2gsm C:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1238860Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 1238861Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 1238862Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 1238863Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species)
  7. 1238867Species Rhodobacter sphaeroides [TaxId:1063] [81435] (6 PDB entries)
  8. 1238873Domain d2gsmc_: 2gsm C: [135592]
    Other proteins in same PDB: d2gsmb1, d2gsmb2, d2gsmd1, d2gsmd2
    automated match to d1m56a_
    complexed with ca, cd, cu, dmu, hea, mg, oh, trd

Details for d2gsmc_

PDB Entry: 2gsm (more details), 2 Å

PDB Description: catalytic core (subunits i and ii) of cytochrome c oxidase from rhodobacter sphaeroides
PDB Compounds: (C:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d2gsmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsmc_ f.24.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]}
ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht

SCOPe Domain Coordinates for d2gsmc_:

Click to download the PDB-style file with coordinates for d2gsmc_.
(The format of our PDB-style files is described here.)

Timeline for d2gsmc_: