Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81457] (6 PDB entries) |
Domain d2gsmb2: 2gsm B:30-129 [135591] Other proteins in same PDB: d2gsma_, d2gsmb1, d2gsmb3, d2gsmc_, d2gsmd1, d2gsmd3 automated match to d3fyeb1 complexed with ca, cd, cu, dmu, hea, mg, oh, trd |
PDB Entry: 2gsm (more details), 2 Å
SCOPe Domain Sequences for d2gsmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsmb2 f.17.2.1 (B:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]} leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk vparfthnspleiawtivpivilvaigafslpvlfnqqei
Timeline for d2gsmb2: