SCOPe 2.05: Domain d2gsmb1: 2gsm B:130-285

Lineage for d2gsmb1 (2gsm B:130-285)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [74870] (6 PDB entries)

8. Domain d2gsmb1: 2gsm B:130-285 [135590]
   Other proteins in same PDB: d2gsma_, d2gsmb2, d2gsmc_, d2gsmd2
   automated match to d3fyeb2
   complexed with ca, cd, cu, dmu, hea, mg, oh, trd

Details for d2gsmb1

PDB Entry: 2gsm, 2 Å

PDB Description: catalytic core (subunits i and ii) of cytochrome c oxidase from rhodobacter sphaeroides

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2gsmb1:

Sequence; same for both SEQRES and ATOM records:

>d2gsmb1 b.6.1.2 (B:130-285) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqhhhh

Timeline for d2gsmb1:

• d2gsmb1 first appeared in SCOP 1.73
  
• d2gsmb1 appears in SCOPe 2.04
  
• d2gsmb1 appears in SCOPe 2.06
  
• d2gsmb1 appears in the current release, SCOPe 2.08