SCOP 1.73: Domain d2gs0a1: 2gs0 A:2-115

Lineage for d2gs0a1 (2gs0 A:2-115)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.9: TFIIH domain [110272] (2 proteins)

6. Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (2 PDB entries)

8. Domain d2gs0a1: 2gs0 A:2-115 [135573]
   automatically matched to 1Y5O A:2-115
   mutant

Details for d2gs0a1

PDB Entry: 2gs0

PDB Description: nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the activation domain of p53

PDB Compounds: (A:) RNA polymerase II transcription factor B subunit 1

SCOP Domain Sequences for d2gs0a1:

Sequence; same for both SEQRES and ATOM records:

>d2gs0a1 b.55.1.9 (A:2-115) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmmlr
ligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

Timeline for d2gs0a1:

• d2gs0a1 is new in SCOP 1.73
  
• d2gs0a1 appears in SCOP 1.75
  
• d2gs0a1 appears in the current release, SCOPe 2.08, called d2gs0a_