SCOPe 2.06: Domain d2grld1: 2grl D:1-66

Lineage for d2grld1 (2grl D:1-66)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (10 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries)

8. Domain d2grld1: 2grl D:1-66 [135566]
   Other proteins in same PDB: d2grla2, d2grlb2, d2grlc2, d2grld2
   automated match to d2awia1

Details for d2grld1

PDB Entry: 2grl, 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex

PDB Compounds: (D:) PrgX

SCOPe Domain Sequences for d2grld1:

Sequence; same for both SEQRES and ATOM records:

>d2grld1 a.35.1.0 (D:1-66) automated matches {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnrag

Timeline for d2grld1:

• d2grld1 first appeared in SCOP 1.73
  
• d2grld1 appears in SCOPe 2.05
  
• d2grld1 appears in SCOPe 2.07
  
• d2grld1 appears in the current release, SCOPe 2.08