SCOP 1.75: Domain d2grlc2: 2grl C:70-287

Lineage for d2grlc2 (2grl C:70-287)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (8 families)

5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein)

6. Protein PrgX [140849] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [140850] (7 PDB entries)
   Uniprot Q04114 70-287! Uniprot Q04114 71-301

8. Domain d2grlc2: 2grl C:70-287 [135565]
   Other proteins in same PDB: d2grla1, d2grlb1, d2grlc1, d2grld1
   automatically matched to 2AW6 A:70-287

Details for d2grlc2

PDB Entry: 2grl, 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex

PDB Compounds: (C:) PrgX

SCOP Domain Sequences for d2grlc2:

Sequence; same for both SEQRES and ATOM records:

>d2grlc2 a.118.8.4 (C:70-287) PrgX {Enterococcus faecalis [TaxId: 1351]}
ksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievpt
fnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlt
iqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdk
nidsylnavniinifkiigkedihrslveeltkisake

Timeline for d2grlc2:

• d2grlc2 first appeared in SCOP 1.73
  
• d2grlc2 appears in SCOPe 2.01
  
• d2grlc2 appears in the current release, SCOPe 2.08