Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) |
Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein) |
Protein PrgX [140849] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [140850] (7 PDB entries) Uniprot Q04114 70-287! Uniprot Q04114 71-301 |
Domain d2grlb2: 2grl B:70-286 [135563] Other proteins in same PDB: d2grla1, d2grlb1, d2grlc1, d2grld1 automatically matched to 2AW6 A:70-287 |
PDB Entry: 2grl (more details), 3 Å
SCOPe Domain Sequences for d2grlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grlb2 a.118.8.4 (B:70-286) PrgX {Enterococcus faecalis [TaxId: 1351]} ksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievpt fnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlt iqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdk nidsylnavniinifkiigkedihrslveeltkisak
Timeline for d2grlb2: