SCOPe 2.01: Domain d2grlb2: 2grl B:70-286

Lineage for d2grlb2 (2grl B:70-286)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein)

6. Protein PrgX [140849] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [140850] (7 PDB entries)
   Uniprot Q04114 70-287! Uniprot Q04114 71-301

8. Domain d2grlb2: 2grl B:70-286 [135563]
   Other proteins in same PDB: d2grla1, d2grlb1, d2grlc1, d2grld1
   automatically matched to 2AW6 A:70-287

Details for d2grlb2

PDB Entry: 2grl, 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex

PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2grlb2:

Sequence; same for both SEQRES and ATOM records:

>d2grlb2 a.118.8.4 (B:70-286) PrgX {Enterococcus faecalis [TaxId: 1351]}
ksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievpt
fnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlt
iqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdk
nidsylnavniinifkiigkedihrslveeltkisak

Timeline for d2grlb2:

• d2grlb2 first appeared in SCOP 1.73
  
• d2grlb2 appears in SCOP 1.75
  
• d2grlb2 appears in SCOPe 2.02
  
• d2grlb2 appears in the current release, SCOPe 2.08