SCOPe 2.01: Domain d2grla1: 2grl A:1-69

Lineage for d2grla1 (2grl A:1-69)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
   Part of Pfam PF01381

6. Protein PrgX [140527] (1 species)
   possibly involved in pheromone-inducible conjugation

7. Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries)
   Uniprot Q04114 1-69! Uniprot Q04114 2-66

8. Domain d2grla1: 2grl A:1-69 [135560]
   Other proteins in same PDB: d2grla2, d2grlb2, d2grlc2, d2grld2
   automatically matched to 2AW6 A:1-69

Details for d2grla1

PDB Entry: 2grl, 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex

PDB Compounds: (A:) PrgX

SCOPe Domain Sequences for d2grla1:

Sequence; same for both SEQRES and ATOM records:

>d2grla1 a.35.1.11 (A:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnragmnt

Timeline for d2grla1:

• d2grla1 first appeared in SCOP 1.73
  
• d2grla1 appears in SCOP 1.75
  
• d2grla1 appears in SCOPe 2.02
  
• d2grla1 appears in the current release, SCOPe 2.08