Lineage for d2gppb_ (2gpp B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923541Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 923542Species Human (Homo sapiens) [TaxId:9606] [81917] (13 PDB entries)
    Uniprot O75454 233-458
  8. 923565Domain d2gppb_: 2gpp B: [135486]
    automated match to d1tfca_
    complexed with 1ba

Details for d2gppb_

PDB Entry: 2gpp (more details), 2.6 Å

PDB Description: Estrogen Related Receptor-gamma ligand binding domain complexed with a RIP140 peptide and synthetic ligand GSK4716
PDB Compounds: (B:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d2gppb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gppb_ a.123.1.1 (B:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
ragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea

SCOPe Domain Coordinates for d2gppb_:

Click to download the PDB-style file with coordinates for d2gppb_.
(The format of our PDB-style files is described here.)

Timeline for d2gppb_: