Lineage for d2gpoa1 (2gpo A:235-458)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776682Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 776683Species Human (Homo sapiens) [TaxId:9606] [81917] (16 PDB entries)
    Uniprot O75454 233-458
  8. 776687Domain d2gpoa1: 2gpo A:235-458 [135484]
    automatically matched to d1tfca_

Details for d2gpoa1

PDB Entry: 2gpo (more details), 1.95 Å

PDB Description: estrogen related receptor-gamma ligand binding domain complexed with a synthetic peptide from rip140
PDB Compounds: (A:) Estrogen-related receptor gamma

SCOP Domain Sequences for d2gpoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpoa1 a.123.1.1 (A:235-458) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv

SCOP Domain Coordinates for d2gpoa1:

Click to download the PDB-style file with coordinates for d2gpoa1.
(The format of our PDB-style files is described here.)

Timeline for d2gpoa1: