SCOPe 2.06: Domain d2gplr_: 2gpl R:

Lineage for d2gplr_ (2gpl R:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d2gplr_: 2gpl R: [135475]
   Other proteins in same PDB: d2gpla_, d2gplb_, d2gplc_, d2gple_, d2gplf_, d2gplg_, d2gplo_, d2gplp_, d2gplq_, d2gpls_, d2gplt_, d2gplu_
   automated match to d1jd2y_
   complexed with biq

Details for d2gplr_

PDB Entry: 2gpl, 2.81 Å

PDB Description: TMC-95 based biphenyl-ether macrocycles: specific proteasome inhibitors

PDB Compounds: (R:) Proteasome component PUP2

SCOPe Domain Sequences for d2gplr_:

Sequence; same for both SEQRES and ATOM records:

>d2gplr_ d.153.1.4 (R:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Timeline for d2gplr_:

• d2gplr_ first appeared in SCOP 1.73, called d2gplr1
  
• d2gplr_ appears in SCOPe 2.05
  
• d2gplr_ appears in SCOPe 2.07
  
• d2gplr_ appears in the current release, SCOPe 2.08