Lineage for d2gplj_ (2gpl J:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045208Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1045217Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (28 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1045404Domain d2gplj_: 2gpl J: [135467]
    Other proteins in same PDB: d2gpla_, d2gplb_, d2gplc_, d2gpld1, d2gple_, d2gplf_, d2gplg_, d2gplo_, d2gplp_, d2gplq_, d2gplr1, d2gpls_, d2gplt_, d2gplu_
    automated match to d1g0uj_
    complexed with biq

Details for d2gplj_

PDB Entry: 2gpl (more details), 2.81 Å

PDB Description: TMC-95 based biphenyl-ether macrocycles: specific proteasome inhibitors
PDB Compounds: (J:) Proteasome component C11

SCOPe Domain Sequences for d2gplj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gplj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddfqaq

SCOPe Domain Coordinates for d2gplj_:

Click to download the PDB-style file with coordinates for d2gplj_.
(The format of our PDB-style files is described here.)

Timeline for d2gplj_: