Lineage for d2gp7a_ (2gp7 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097327Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 1097328Species Human (Homo sapiens) [TaxId:9606] [81917] (13 PDB entries)
    Uniprot O75454 233-458
  8. 1097344Domain d2gp7a_: 2gp7 A: [135452]
    automated match to d1tfca_
    complexed with ca

Details for d2gp7a_

PDB Entry: 2gp7 (more details), 2.45 Å

PDB Description: Estrogen Related Receptor-gamma ligand binding domain
PDB Compounds: (A:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d2gp7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gp7a_ a.123.1.1 (A:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv

SCOPe Domain Coordinates for d2gp7a_:

Click to download the PDB-style file with coordinates for d2gp7a_.
(The format of our PDB-style files is described here.)

Timeline for d2gp7a_: