SCOPe 2.05: Domain d2gp4b1: 2gp4 B:419-608

Lineage for d2gp4b1 (2gp4 B:419-608)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.2: IlvD/EDD C-terminal domain-like [141976] (1 protein)
   C-terminal part of Pfam PF00920

6. Protein 6-phosphogluconate dehydratase EDD [141977] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [141978] (1 PDB entry)
   Uniprot Q8EEA0 419-608

8. Domain d2gp4b1: 2gp4 B:419-608 [135450]
   Other proteins in same PDB: d2gp4a2, d2gp4b2
   automated match to d2gp4a1

Details for d2gp4b1

PDB Entry: 2gp4, 2.49 Å

PDB Description: Structure of [FeS]cluster-free Apo Form of 6-Phosphogluconate Dehydratase from Shewanella oneidensis

PDB Compounds: (B:) 6-phosphogluconate dehydratase

SCOPe Domain Sequences for d2gp4b1:

Sequence; same for both SEQRES and ATOM records:

>d2gp4b1 c.8.2.2 (B:419-608) 6-phosphogluconate dehydratase EDD {Shewanella oneidensis [TaxId: 70863]}
glkllkgnlgravikvsavqpqhrvveapavviddqnkldalfksgaldrdcvvvvkgqg
pkangmpelhkltpllgslqdkgfkvalmtdgrmsgasgkvpaaihltpeaidggliakv
qdgdlirvdaltgelsllvsdtelatrtateidlrhsrygmgrelfgvlrsnlsspetga
rstsaidely

Timeline for d2gp4b1:

• d2gp4b1 first appeared in SCOP 1.73
  
• d2gp4b1 appears in SCOPe 2.04
  
• d2gp4b1 appears in SCOPe 2.06
  
• d2gp4b1 appears in the current release, SCOPe 2.08