Lineage for d2gooe_ (2goo E:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583547Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2583548Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2583778Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2583779Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 2583780Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)
  8. 2583792Domain d2gooe_: 2goo E: [135445]
    Other proteins in same PDB: d2gooa_, d2gooc_, d2good_, d2goof_
    automated match to d3qb4d_
    complexed with ndg

Details for d2gooe_

PDB Entry: 2goo (more details), 2.2 Å

PDB Description: ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd
PDB Compounds: (E:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d2gooe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gooe_ g.7.1.3 (E:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
lpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspk
aqlrrtieccrtnlcnqylqptlppvvi

SCOPe Domain Coordinates for d2gooe_:

Click to download the PDB-style file with coordinates for d2gooe_.
(The format of our PDB-style files is described here.)

Timeline for d2gooe_: