SCOPe 2.04: Domain d2gooc_: 2goo C:

Lineage for d2gooc_ (2goo C:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein Type II activin receptor [57357] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries)

8. Domain d2gooc_: 2goo C: [135443]
   Other proteins in same PDB: d2gooa_, d2goob_, d2good_, d2gooe_
   automated match to d1btea_
   complexed with ndg

Details for d2gooc_

PDB Entry: 2goo, 2.2 Å

PDB Description: ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd

PDB Compounds: (C:) Activin receptor type 2A

SCOPe Domain Sequences for d2gooc_:

Sequence; same for both SEQRES and ATOM records:

>d2gooc_ g.7.1.3 (C:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
tqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddincy
drtdciekkdspevyfcccegnmcnekfsyfp

Timeline for d2gooc_:

• d2gooc_ first appeared in SCOP 1.73, called d2gooc1
  
• d2gooc_ appears in SCOPe 2.03
  
• d2gooc_ appears in SCOPe 2.05
  
• d2gooc_ appears in the current release, SCOPe 2.08