Lineage for d2goob1 (2goo B:34-118)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748275Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 748276Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 748462Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)
  6. 748463Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 748464Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries)
  8. 748469Domain d2goob1: 2goo B:34-118 [135442]
    Other proteins in same PDB: d2gooa1, d2gooc1, d2good1, d2goof1
    automatically matched to d1es7d_
    complexed with ndg

Details for d2goob1

PDB Entry: 2goo (more details), 2.2 Å

PDB Description: ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd
PDB Compounds: (B:) Bone morphogenetic protein receptor type IA

SCOP Domain Sequences for d2goob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2goob1 g.7.1.3 (B:34-118) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlppv

SCOP Domain Coordinates for d2goob1:

Click to download the PDB-style file with coordinates for d2goob1.
(The format of our PDB-style files is described here.)

Timeline for d2goob1: