Lineage for d2gola1 (2gol A:7-107)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771619Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 771620Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 771621Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (2 proteins)
  6. 771622Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
    topologically similar to one subunit in the interferon-gamma intertwined dimer
  7. 771623Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (12 PDB entries)
  8. 771624Domain d2gola1: 2gol A:7-107 [135438]
    Other proteins in same PDB: d2golb1, d2gold1
    automatically matched to d1hiwa_
    complexed with so4

Details for d2gola1

PDB Entry: 2gol (more details), 2.2 Å

PDB Description: Xray Structure of Gag278
PDB Compounds: (A:) Matrix protein p17 (MA)

SCOP Domain Sequences for d2gola1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gola1 a.61.1.1 (A:7-107) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
slqtgseelrslyntiavlycvhqridvkdtkealdkieee

SCOP Domain Coordinates for d2gola1:

Click to download the PDB-style file with coordinates for d2gola1.
(The format of our PDB-style files is described here.)

Timeline for d2gola1: