Lineage for d2gmyc1 (2gmy C:2-147)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779114Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 779115Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 779171Family a.152.1.3: Atu0492-like [140970] (5 proteins)
    duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
  6. 779172Protein Hypothetical protein Atu0492 [140971] (1 species)
  7. 779173Species Agrobacterium tumefaciens [TaxId:358] [140972] (1 PDB entry)
    Uniprot Q8UI08 2-148
  8. 779176Domain d2gmyc1: 2gmy C:2-147 [135400]
    automatically matched to 2GMY A:2-148

Details for d2gmyc1

PDB Entry: 2gmy (more details), 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function ATU0492 from Agrobacterium tumefaciens, Putative Antioxidant Defence Protein AhpD
PDB Compounds: (C:) Hypothetical protein Atu0492

SCOP Domain Sequences for d2gmyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmyc1 a.152.1.3 (C:2-147) Hypothetical protein Atu0492 {Agrobacterium tumefaciens [TaxId: 358]}
ktrinyakaspeafkavmalenyvqssglehrfihliklrasiingcafcvdmhvkesrh
dglseqwinlmsvwrespvyteqerallgwvdavtkiaetgapddafetlrahfsdeeiv
kitvaigaintwnriavgfrsqhpve

SCOP Domain Coordinates for d2gmyc1:

Click to download the PDB-style file with coordinates for d2gmyc1.
(The format of our PDB-style files is described here.)

Timeline for d2gmyc1: