Lineage for d2gmrm_ (2gmr M:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958788Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1958789Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1958790Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1958875Protein M (medium) subunit [81481] (3 species)
  7. 1958876Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
    Uniprot P02953
  8. 1958897Domain d2gmrm_: 2gmr M: [135393]
    Other proteins in same PDB: d2gmrh1, d2gmrh2, d2gmrl1
    automated match to d1ystm_
    complexed with bcl, bph, fe2, lda, spn, u10; mutant

Details for d2gmrm_

PDB Entry: 2gmr (more details), 2.5 Å

PDB Description: photosynthetic reaction center mutant from rhodobacter sphaeroides with asp l210 replaced with asn
PDB Compounds: (M:) Photosynthetic Reaction center protein M chain

SCOPe Domain Sequences for d2gmrm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmrm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
qnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsg
lmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmf
vavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshl
dwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgt
aaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn

SCOPe Domain Coordinates for d2gmrm_:

Click to download the PDB-style file with coordinates for d2gmrm_.
(The format of our PDB-style files is described here.)

Timeline for d2gmrm_: