SCOPe 2.04: Domain d2gmrm_: 2gmr M:

Lineage for d2gmrm_ (2gmr M:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
   Uniprot P02953

8. Domain d2gmrm_: 2gmr M: [135393]
   Other proteins in same PDB: d2gmrh1, d2gmrh2, d2gmrl1
   automated match to d1ystm_
   complexed with bcl, bph, fe2, lda, spn, u10; mutant

Details for d2gmrm_

PDB Entry: 2gmr, 2.5 Å

PDB Description: photosynthetic reaction center mutant from rhodobacter sphaeroides with asp l210 replaced with asn

PDB Compounds: (M:) Photosynthetic Reaction center protein M chain

SCOPe Domain Sequences for d2gmrm_:

Sequence; same for both SEQRES and ATOM records:

>d2gmrm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
qnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsg
lmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmf
vavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshl
dwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgt
aaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn

Timeline for d2gmrm_:

• d2gmrm_ first appeared in SCOP 1.73, called d2gmrm1
  
• d2gmrm_ appears in SCOPe 2.03
  
• d2gmrm_ appears in SCOPe 2.05
  
• d2gmrm_ appears in the current release, SCOPe 2.08