SCOP 1.75: Domain d2gmrm1: 2gmr M:4-300

Lineage for d2gmrm1 (2gmr M:4-300)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
   Uniprot P02953

8. Domain d2gmrm1: 2gmr M:4-300 [135393]
   Other proteins in same PDB: d2gmrl1
   automatically matched to d2rcrm_
   complexed with bcl, bph, fe2, lda, spn, u10; mutant

Details for d2gmrm1

PDB Entry: 2gmr, 2.5 Å

PDB Description: photosynthetic reaction center mutant from rhodobacter sphaeroides with asp l210 replaced with asn

PDB Compounds: (M:) Photosynthetic Reaction center protein M chain

SCOP Domain Sequences for d2gmrm1:

Sequence; same for both SEQRES and ATOM records:

>d2gmrm1 f.26.1.1 (M:4-300) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
qnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsg
lmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmf
vavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshl
dwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgt
aaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn

Timeline for d2gmrm1:

• d2gmrm1 first appeared in SCOP 1.73
  
• d2gmrm1 is called d2gmrm_ in SCOPe 2.01
  
• d2gmrm1 appears in the current release, SCOPe 2.08, called d2gmrm_