Lineage for d2gmib1 (2gmi B:3-137)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720015Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)
  7. 720018Species Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId:4932] [64241] (2 PDB entries)
  8. 720020Domain d2gmib1: 2gmi B:3-137 [135381]
    Other proteins in same PDB: d2gmic1
    automatically matched to d1jatb_
    mutant

Details for d2gmib1

PDB Entry: 2gmi (more details), 2.5 Å

PDB Description: Mms2/Ubc13~Ubiquitin
PDB Compounds: (B:) Ubiquitin-conjugating enzyme variant MMS2

SCOP Domain Sequences for d2gmib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmib1 d.20.1.1 (B:3-137) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]}
kvprnfrlleelekgekgfgpescsygladsdditmtkwngtilgpphsnhenriyslsi
dcgpnypdsppkvtfiskinlpcvnpttgevqtdfhtlrdwkraytmetllldlrkemat
pankklrqpkegetf

SCOP Domain Coordinates for d2gmib1:

Click to download the PDB-style file with coordinates for d2gmib1.
(The format of our PDB-style files is described here.)

Timeline for d2gmib1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gmic1