Lineage for d2gm8c_ (2gm8 C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925023Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 925024Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 925228Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 925229Protein automated matches [190172] (5 species)
    not a true protein
  7. 925234Species Pyrobaculum aerophilum [TaxId:178306] [187120] (2 PDB entries)
  8. 925237Domain d2gm8c_: 2gm8 C: [135370]
    automated match to d1udda_
    complexed with edo, hmh

Details for d2gm8c_

PDB Entry: 2gm8 (more details), 2.5 Å

PDB Description: tena homolog/thi-4 thiaminase complexed with product 4-amino-5- hydroxymethyl-2-methylpyrimidine
PDB Compounds: (C:) tenA homolog/Thi-4 Thiaminase

SCOPe Domain Sequences for d2gm8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gm8c_ a.132.1.0 (C:) automated matches {Pyrobaculum aerophilum [TaxId: 178306]}
hhhgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalsla
asrapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylks
tcalegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlr
avldssglsaeelwpyfkeaslyelefwqaayegh

SCOPe Domain Coordinates for d2gm8c_:

Click to download the PDB-style file with coordinates for d2gm8c_.
(The format of our PDB-style files is described here.)

Timeline for d2gm8c_: