Lineage for d2gm8c1 (2gm8 C:2-212)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777877Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 777916Protein TenA homolog PAE0170 [140952] (1 species)
  7. 777917Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [140953] (2 PDB entries)
    Uniprot Q8ZZM9 2-212
  8. 777920Domain d2gm8c1: 2gm8 C:2-212 [135370]
    automatically matched to 2GM7 A:2-212
    complexed with edo, hmh

Details for d2gm8c1

PDB Entry: 2gm8 (more details), 2.5 Å

PDB Description: tena homolog/thi-4 thiaminase complexed with product 4-amino-5- hydroxymethyl-2-methylpyrimidine
PDB Compounds: (C:) tenA homolog/Thi-4 Thiaminase

SCOP Domain Sequences for d2gm8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gm8c1 a.132.1.3 (C:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
vtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaasra
psvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstcal
egfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlravld
ssglsaeelwpyfkeaslyelefwqaayegh

SCOP Domain Coordinates for d2gm8c1:

Click to download the PDB-style file with coordinates for d2gm8c1.
(The format of our PDB-style files is described here.)

Timeline for d2gm8c1: