SCOP 1.75: Domain d2gm8a1: 2gm8 A:2-212

Lineage for d2gm8a1 (2gm8 A:2-212)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein TenA homolog PAE0170 [140952] (1 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [140953] (2 PDB entries)
   Uniprot Q8ZZM9 2-212

8. Domain d2gm8a1: 2gm8 A:2-212 [135368]
   automatically matched to 2GM7 A:2-212
   complexed with edo, hmh

Details for d2gm8a1

PDB Entry: 2gm8, 2.5 Å

PDB Description: tena homolog/thi-4 thiaminase complexed with product 4-amino-5- hydroxymethyl-2-methylpyrimidine

PDB Compounds: (A:) tenA homolog/Thi-4 Thiaminase

SCOP Domain Sequences for d2gm8a1:

Sequence; same for both SEQRES and ATOM records:

>d2gm8a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
vtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaasra
psvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstcal
egfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlravld
ssglsaeelwpyfkeaslyelefwqaayegh

Timeline for d2gm8a1:

• d2gm8a1 first appeared in SCOP 1.73
  
• d2gm8a1 is called d2gm8a_ in SCOPe 2.01
  
• d2gm8a1 appears in the current release, SCOPe 2.08, called d2gm8a2