SCOPe 2.02: Domain d2gm7d_: 2gm7 D:

Lineage for d2gm7d_ (2gm7 D:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (6 species)
   not a true protein

7. Species Pyrobaculum aerophilum [TaxId:178306] [187120] (2 PDB entries)

8. Domain d2gm7d_: 2gm7 D: [135367]
   Other proteins in same PDB: d2gm7a1
   automated match to d1udda_
   complexed with gol, pe4, po4

Details for d2gm7d_

PDB Entry: 2gm7, 2.8 Å

PDB Description: tena homolog/thi-4 thiaminase from pyrobaculum aerophilum

PDB Compounds: (D:) tenA homolog/Thi-4 Thiaminase

SCOPe Domain Sequences for d2gm7d_:

Sequence; same for both SEQRES and ATOM records:

>d2gm7d_ a.132.1.0 (D:) automated matches {Pyrobaculum aerophilum [TaxId: 178306]}
hhhhgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalsl
aasrapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylk
stcalegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverl
ravldssglsaeelwpyfkeaslyelefwqaayegh

Timeline for d2gm7d_:

• d2gm7d_ first appeared in SCOP 1.73, called d2gm7d1
  
• d2gm7d_ appears in SCOPe 2.01
  
• d2gm7d_ appears in SCOPe 2.03
  
• d2gm7d_ appears in the current release, SCOPe 2.08, called d2gm7d2