Class a: All alpha proteins [46456] (284 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.3: TENA/THI-4 [101458] (8 proteins) Pfam PF03070; HO-related family lacking the heme-binding site |
Protein TenA homolog PAE0170 [140952] (1 species) |
Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [140953] (2 PDB entries) Uniprot Q8ZZM9 2-212 |
Domain d2gm7c1: 2gm7 C:2-212 [135366] automatically matched to 2GM7 A:2-212 complexed with gol, pe4, po4 |
PDB Entry: 2gm7 (more details), 2.8 Å
SCOP Domain Sequences for d2gm7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gm7c1 a.132.1.3 (C:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} vtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaasra psvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstcal egfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlravld ssglsaeelwpyfkeaslyelefwqaayegh
Timeline for d2gm7c1: