Lineage for d2gm7a1 (2gm7 A:2-212)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648983Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 648984Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 649094Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 649133Protein TenA homolog PAE0170 [140952] (1 species)
  7. 649134Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [140953] (2 PDB entries)
  8. 649139Domain d2gm7a1: 2gm7 A:2-212 [135364]
    complexed with gol, pe4, po4

Details for d2gm7a1

PDB Entry: 2gm7 (more details), 2.8 Å

PDB Description: tena homolog/thi-4 thiaminase from pyrobaculum aerophilum
PDB Compounds: (A:) tenA homolog/Thi-4 Thiaminase

SCOP Domain Sequences for d2gm7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gm7a1 a.132.1.3 (A:2-212) TenA homolog PAE0170 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
vtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaasra
psvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstcal
egfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlravld
ssglsaeelwpyfkeaslyelefwqaayegh

SCOP Domain Coordinates for d2gm7a1:

Click to download the PDB-style file with coordinates for d2gm7a1.
(The format of our PDB-style files is described here.)

Timeline for d2gm7a1: