![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
![]() | Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries) |
![]() | Domain d2gjxf2: 2gjx F:54-199 [135316] Other proteins in same PDB: d2gjxa1, d2gjxa2, d2gjxb1, d2gjxc1, d2gjxd1, d2gjxd2, d2gjxe1, d2gjxe2, d2gjxf1, d2gjxg1, d2gjxh1, d2gjxh2 automated match to d1np0a2 complexed with nag, so4 |
PDB Entry: 2gjx (more details), 2.8 Å
SCOPe Domain Sequences for d2gjxf2:
Sequence, based on SEQRES records: (download)
>d2gjxf2 d.92.2.1 (F:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle tfsqlvyqdsygtftinestiidspr
>d2gjxf2 d.92.2.1 (F:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf tinestiidspr
Timeline for d2gjxf2: