SCOPe 2.03: Domain d2gjsb_: 2gjs B:

Lineage for d2gjsb_ (2gjs B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (75 PDB entries)

8. Domain d2gjsb_: 2gjs B: [135288]
   Other proteins in same PDB: d2gjsa1
   automated match to d1uada_
   complexed with gdp, mg

Details for d2gjsb_

PDB Entry: 2gjs, 1.9 Å

PDB Description: The crystal structure of human RRAD in complex with GDP

PDB Compounds: (B:) GTP-binding protein RAD

SCOPe Domain Sequences for d2gjsb_:

Sequence, based on SEQRES records:

>d2gjsb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvydiweqdg
grwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnksdlvrs
revsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrrd

Sequence, based on observed residues (ATOM records):

>d2gjsb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vykvlllgapgvgksalarifggvehtydrsivvdgeeaslmvydimgdayvivysvtdk
gsfekaselrvqlrrardvpiilvgnksdlvrsrevsvdegracavvfdckfietsaalh
hnvqalfegvvrqirlrrd

Timeline for d2gjsb_:

• d2gjsb_ first appeared in SCOP 1.73, called d2gjsb1
  
• d2gjsb_ appears in SCOPe 2.02
  
• d2gjsb_ appears in SCOPe 2.04
  
• d2gjsb_ appears in the current release, SCOPe 2.08