Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186862] (75 PDB entries) |
Domain d2gjsb_: 2gjs B: [135288] Other proteins in same PDB: d2gjsa1 automated match to d1uada_ complexed with gdp, mg |
PDB Entry: 2gjs (more details), 1.9 Å
SCOPe Domain Sequences for d2gjsb_:
Sequence, based on SEQRES records: (download)
>d2gjsb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvydiweqdg grwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnksdlvrs revsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrrd
>d2gjsb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vykvlllgapgvgksalarifggvehtydrsivvdgeeaslmvydimgdayvivysvtdk gsfekaselrvqlrrardvpiilvgnksdlvrsrevsvdegracavvfdckfietsaalh hnvqalfegvvrqirlrrd
Timeline for d2gjsb_: