Lineage for d2gjsa1 (2gjs A:91-258)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867615Protein Rad [142295] (1 species)
  7. 2867616Species Human (Homo sapiens) [TaxId:9606] [142296] (1 PDB entry)
    Uniprot P55042 91-258
  8. 2867617Domain d2gjsa1: 2gjs A:91-258 [135287]
    Other proteins in same PDB: d2gjsb_
    complexed with gdp, mg

Details for d2gjsa1

PDB Entry: 2gjs (more details), 1.9 Å

PDB Description: The crystal structure of human RRAD in complex with GDP
PDB Compounds: (A:) GTP-binding protein RAD

SCOPe Domain Sequences for d2gjsa1:

Sequence, based on SEQRES records: (download)

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}
vykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvydiweqdg
grwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnksdlvrs
revsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrrdsk

Sequence, based on observed residues (ATOM records): (download)

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}
vykvlllgapgvgksalarifggvghtydrsivvdgeeaslmvydiwlpghcmamgdayv
ivysvtdkgsfekaselrvqlrrarqdvpiilvgnksdlvrsrevsvdegracavvfdck
fietsaalhhnvqalfegvvrqirlrrdsk

SCOPe Domain Coordinates for d2gjsa1:

Click to download the PDB-style file with coordinates for d2gjsa1.
(The format of our PDB-style files is described here.)

Timeline for d2gjsa1: