Lineage for d2gj7f1 (2gj7 F:220-390)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 651990Protein Alphaherpesvirus glycoprotein E [141008] (1 species)
    elaborated with insertions and C-terminal extensions
  7. 651991Species Human herpesvirus 1 [TaxId:10298] [141009] (2 PDB entries)
  8. 651995Domain d2gj7f1: 2gj7 F:220-390 [135269]
    Other proteins in same PDB: d2gj7a1, d2gj7a2, d2gj7b1, d2gj7b2
    automatically matched to 2GJ7 E:220-390
    complexed with bma, fuc, gal, man, nag

Details for d2gj7f1

PDB Entry: 2gj7 (more details), 5 Å

PDB Description: crystal structure of a ge-gi/fc complex
PDB Compounds: (F:) Glycoprotein E

SCOP Domain Sequences for d2gj7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj7f1 b.1.1.1 (F:220-390) Alphaherpesvirus glycoprotein E {Human herpesvirus 1 [TaxId: 10298]}
rgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriyes
clyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglawqa
asvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpl

SCOP Domain Coordinates for d2gj7f1:

Click to download the PDB-style file with coordinates for d2gj7f1.
(The format of our PDB-style files is described here.)

Timeline for d2gj7f1: