![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
![]() | Protein Alphaherpesvirus glycoprotein E [141008] (1 species) elaborated with insertions and C-terminal extensions |
![]() | Species Human herpesvirus 1 [TaxId:10298] [141009] (2 PDB entries) |
![]() | Domain d2gj7e1: 2gj7 E:220-390 [135268] Other proteins in same PDB: d2gj7a1, d2gj7a2, d2gj7b1, d2gj7b2 complexed with bma, fuc, gal, man, nag |
PDB Entry: 2gj7 (more details), 5 Å
SCOP Domain Sequences for d2gj7e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj7e1 b.1.1.1 (E:220-390) Alphaherpesvirus glycoprotein E {Human herpesvirus 1 [TaxId: 10298]} rgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriyes clyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglawqa asvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpl
Timeline for d2gj7e1: