Lineage for d2gj7a1 (2gj7 A:237-339)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655804Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 655805Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)
  8. 655841Domain d2gj7a1: 2gj7 A:237-339 [135264]
    Other proteins in same PDB: d2gj7a2, d2gj7b2, d2gj7e1, d2gj7f1
    automatically matched to d1hzhh3
    complexed with bma, fuc, gal, man, nag

Details for d2gj7a1

PDB Entry: 2gj7 (more details), 5 Å

PDB Description: Crystal Structure of a gE-gI/Fc complex
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOP Domain Sequences for d2gj7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj7a1 b.1.1.2 (A:237-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOP Domain Coordinates for d2gj7a1:

Click to download the PDB-style file with coordinates for d2gj7a1.
(The format of our PDB-style files is described here.)

Timeline for d2gj7a1: